Recombinant Human BPIFA2 Protein (14-249 aa), His-SUMOSTAR-tagged

• Cat.No.: BPIFA2-2254H
• Product Overview: Recombinant Human BPIFA2 Protein (14-249 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMOSTAR tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Full Length.

Specification

• Description: Has strong antibacterial activity against P. aeruginosa.
• Source: Yeast
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 41.1 kDa
• Protein length: 14-249 aa
• AA Sequence: ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BPIFA2 BPI fold containing family A, member 2 [ Homo sapiens ]
• Official Symbol: BPIFA2
• Synonyms: BPIFA2; bA49G10.1; PSP; SPLUNC2; parotid secretory protein; C20orf70
• Gene ID: 140683
• mRNA Refseq: NM_080574
• Protein Refseq: NP_542141
• UniProt ID: Q96DR5