Recombinant Human BNIP3 Protein, GST-tagged

• Cat.No.: BNIP3-294H
• Product Overview: Human BNIP3 full-length ORF (NP_004043.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. This gene contains a BH3 domain and a transmembrane domain, which have been associated with pro-apoptotic function. The dimeric mitochondrial protein encoded by this gene is known to induce apoptosis, even in the presence of BCL2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47.74 kDa
• AA Sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BNIP3 BCL2/adenovirus E1B 19kDa interacting protein 3 [ Homo sapiens ]
• Official Symbol: BNIP3
• Synonyms: BNIP3; BCL2/adenovirus E1B 19kDa interacting protein 3; BCL2/adenovirus E1B 19kD interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; Nip3; NIP3
• Gene ID: 664
• mRNA Refseq: NM_004052
• Protein Refseq: NP_004043
• MIM: 603293
• UniProt ID: Q12983