Recombinant Human BNIP3, GST-tagged
Cat.No. : | BNIP3-810H |
Product Overview : | Recombinant Human BNIP3(NP_004043)(68-121 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 68-121 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | PRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BNIP3 BCL2 interacting protein 3 [ Homo sapiens (human) ] |
Official Symbol | BNIP3 |
Synonyms | NIP3; BNIP3 |
Gene ID | 664 |
mRNA Refseq | NM_004052.4 |
Protein Refseq | NP_004043 |
MIM | 603293 |
UniProt ID | Q12983 |
◆ Recombinant Proteins | ||
Bnip3-2355M | Recombinant Mouse Bnip3 Transmembrane protein, His-tagged | +Inquiry |
Bnip3-1684R | Recombinant Rat Bnip3 protein, His & GST-tagged | +Inquiry |
BNIP3-809H | Recombinant Human BNIP3 Protein, His-tagged | +Inquiry |
BNIP3-1062M | Recombinant Mouse BNIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bnip3-2354M | Recombinant Mouse Bnip3 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BNIP3 Products
Required fields are marked with *
My Review for All BNIP3 Products
Required fields are marked with *
0
Inquiry Basket