Recombinant Human BMP10 Protein, GST-tagged
Cat.No. : | BMP10-258H |
Product Overview : | Human BMP10 partial ORF ( NP_055297, 317 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the TGF-beta family of growth factors. Data suggest that the similar protein in mouse plays an important role in trabeculation of the embryonic heart. In human, this protein may signal through receptor serine/threonine kinases. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP10 bone morphogenetic protein 10 [ Homo sapiens ] |
Official Symbol | BMP10 |
Synonyms | BMP10; bone morphogenetic protein 10; MGC126783; |
Gene ID | 27302 |
mRNA Refseq | NM_014482 |
Protein Refseq | NP_055297 |
MIM | 608748 |
UniProt ID | O95393 |
◆ Recombinant Proteins | ||
BMP10-1722HF | Recombinant Full Length Human BMP10 Protein, GST-tagged | +Inquiry |
BMP10-1051M | Recombinant Mouse BMP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP10-26H | Recombinant Human Bone Morphogenetic Protein 10 | +Inquiry |
BMP10-7083Z | Recombinant Zebrafish BMP10 | +Inquiry |
BMP10-486H | Recombinant Human BMP10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP10-8435HCL | Recombinant Human BMP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP10 Products
Required fields are marked with *
My Review for All BMP10 Products
Required fields are marked with *
0
Inquiry Basket