Recombinant Active Human BMP10 Protein, His-tagged(C-ter)

• Cat.No.: BMP10-09H
• Product Overview: Recombinant Active Human BMP10 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the TGF-beta family of growth factors. Data suggest that the similar protein in mouse plays an important role in trabeculation of the embryonic heart. In human, this protein may signal through receptor serine/threonine kinases. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 1.7-2.1 ng/mL.
• AA Sequence: MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: BMP10 bone morphogenetic protein 10 [ Homo sapiens ]
• Official Symbol: BMP10
• Synonyms: BMP10; bone morphogenetic protein 10; MGC126783
• Gene ID: 27302
• mRNA Refseq: NM_014482
• Protein Refseq: NP_055297
• MIM: 608748
• UniProt ID: O95393