Recombinant Human BLVRB Protein, GST-tagged

Cat.No. : BLVRB-251H
Product Overview : Human BLVRB partial ORF ( NP_000704, 107 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLVRB biliverdin reductase B (flavin reductase (NADPH)) [ Homo sapiens ]
Official Symbol BLVRB
Synonyms BLVRB; biliverdin reductase B (flavin reductase (NADPH)); Flavin reductase , FLR; flavin reductase (NADPH); SDR43U1; short chain dehydrogenase/reductase family 43U; member 1; FR; GHBP; BVR-B; NADPH-flavin reductase; NADPH-dependent diaphorase; green heme-binding protein; biliverdin-IX beta-reductase; short chain dehydrogenase/reductase family 43U, member 1; FLR; BVRB; MGC117413;
Gene ID 645
mRNA Refseq NM_000713
Protein Refseq NP_000704
MIM 600941
UniProt ID P30043

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLVRB Products

Required fields are marked with *

My Review for All BLVRB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon