Recombinant Human BLVRB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BLVRB-1389H
• Product Overview: BLVRB MS Standard C13 and N15-labeled recombinant protein (NP_000704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.1 kDa
• AA Sequence: MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BLVRB biliverdin reductase B [ Homo sapiens (human) ]
• Official Symbol: BLVRB
• Synonyms: BLVRB; biliverdin reductase B (flavin reductase (NADPH)); Flavin reductase, FLR; flavin reductase (NADPH); SDR43U1; short chain dehydrogenase/reductase family 43U; member 1; FR; GHBP; BVR-B; NADPH-flavin reductase; NADPH-dependent diaphorase; green heme-binding protein; biliverdin-IX beta-reductase; short chain dehydrogenase/reductase family 43U, member 1; FLR; BVRB; MGC117413
• Gene ID: 645
• mRNA Refseq: NM_000713
• Protein Refseq: NP_000704
• MIM: 600941
• UniProt ID: P30043