Recombinant Human BLVRB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BLVRB-1389H |
Product Overview : | BLVRB MS Standard C13 and N15-labeled recombinant protein (NP_000704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24). |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BLVRB biliverdin reductase B [ Homo sapiens (human) ] |
Official Symbol | BLVRB |
Synonyms | BLVRB; biliverdin reductase B (flavin reductase (NADPH)); Flavin reductase, FLR; flavin reductase (NADPH); SDR43U1; short chain dehydrogenase/reductase family 43U; member 1; FR; GHBP; BVR-B; NADPH-flavin reductase; NADPH-dependent diaphorase; green heme-binding protein; biliverdin-IX beta-reductase; short chain dehydrogenase/reductase family 43U, member 1; FLR; BVRB; MGC117413; |
Gene ID | 645 |
mRNA Refseq | NM_000713 |
Protein Refseq | NP_000704 |
MIM | 600941 |
UniProt ID | P30043 |
◆ Recombinant Proteins | ||
BLVRB-2498H | Recombinant Human BLVRB protein, His-tagged | +Inquiry |
BLVRB-1713HF | Recombinant Full Length Human BLVRB Protein, GST-tagged | +Inquiry |
BLVRB-10243H | Recombinant Human BLVRB, GST-tagged | +Inquiry |
BLVRB-792Z | Recombinant Zebrafish BLVRB | +Inquiry |
BLVRB-251H | Recombinant Human BLVRB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLVRB-8440HCL | Recombinant Human BLVRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BLVRB Products
Required fields are marked with *
My Review for All BLVRB Products
Required fields are marked with *
0
Inquiry Basket