Recombinant Human BLOC1S1 Protein, GST-tagged

Cat.No. : BLOC1S1-247H
Product Overview : Human BLOC1S1 partial ORF ( NP_001478, 31 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]).
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.08 kDa
AA Sequence : ATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLOC1S1 biogenesis of lysosomal organelles complex-1, subunit 1 [ Homo sapiens ]
Official Symbol BLOC1S1
Synonyms RT14; BLOS1; MICoA; GCN5L1
Gene ID 2647
mRNA Refseq NM_001487.3
Protein Refseq NP_001478.2
MIM 601444
UniProt ID P78537

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLOC1S1 Products

Required fields are marked with *

My Review for All BLOC1S1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon