Recombinant Full Length Human BLOC1S1 Protein, GST-tagged

• Cat.No.: BLOC1S1-1710HF
• Product Overview: Human BLOC1S1 full-length ORF ( NP_001478.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]).
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 40.7 kDa
• Protein length: 125 amino acids
• AA Sequence: MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLOC1S1 biogenesis of lysosomal organelles complex-1, subunit 1 [ Homo sapiens ]
• Official Symbol: BLOC1S1
• Synonyms: RT14; BLOS1; MICoA; GCN5L1
• Gene ID: 2647
• mRNA Refseq: NM_001487.3
• Protein Refseq: NP_001478.2
• MIM: 601444
• UniProt ID: P78537