Recombinant Human BLM Protein, GST-tagged

Cat.No. : BLM-241H
Product Overview : Human BLM partial ORF ( NP_000048, 1196 a.a. - 1295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The Bloom syndrome gene product is related to the RecQ subset of DExH box-containing DNA helicases and has both DNA-stimulated ATPase and ATP-dependent DNA helicase activities. Mutations causing Bloom syndrome delete or alter helicase motifs and may disable the 3-5 helicase activity. The normal protein may act to suppress inappropriate recombination.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLM Bloom syndrome, RecQ helicase-like [ Homo sapiens ]
Official Symbol BLM
Synonyms BLM; Bloom syndrome, RecQ helicase-like; Bloom syndrome; Bloom syndrome protein; BS; RECQ2; RECQL3; recQ protein-like 3; DNA helicase, RecQ-like type 2; RECQL2; MGC126616; MGC131618; MGC131620;
Gene ID 641
mRNA Refseq NM_000057
Protein Refseq NP_000048
MIM 604610
UniProt ID P54132

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLM Products

Required fields are marked with *

My Review for All BLM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon