Recombinant Human BLM Protein, GST-tagged

• Cat.No.: BLM-241H
• Product Overview: Human BLM partial ORF ( NP_000048, 1196 a.a. - 1295 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The Bloom syndrome gene product is related to the RecQ subset of DExH box-containing DNA helicases and has both DNA-stimulated ATPase and ATP-dependent DNA helicase activities. Mutations causing Bloom syndrome delete or alter helicase motifs and may disable the 3-5 helicase activity. The normal protein may act to suppress inappropriate recombination.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLM Bloom syndrome, RecQ helicase-like [ Homo sapiens ]
• Official Symbol: BLM
• Synonyms: BLM; Bloom syndrome, RecQ helicase-like; Bloom syndrome; Bloom syndrome protein; BS; RECQ2; RECQL3; recQ protein-like 3; DNA helicase, RecQ-like type 2; RECQL2; MGC126616; MGC131618; MGC131620
• Gene ID: 641
• mRNA Refseq: NM_000057
• Protein Refseq: NP_000048
• MIM: 604610
• UniProt ID: P54132