Recombinant Human BLK Protein, GST-His-tagged

• Cat.No.: BLK-240H
• Product Overview: Human BLK partial ORF ( AAH07371, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.53 kDa
• AA Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLK B lymphoid tyrosine kinase [ Homo sapiens ]
• Official Symbol: BLK
• Synonyms: BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11
• Gene ID: 640
• mRNA Refseq: NM_001715
• Protein Refseq: NP_001706
• MIM: 191305
• UniProt ID: P51451