Recombinant Human BID protein, His-SUMO-tagged

• Cat.No.: BID-2592H
• Product Overview: Recombinant Human BID protein(P55957)(1-195aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-195aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38 kDa
• AA Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BID BH3 interacting domain death agonist [ Homo sapiens ]
• Official Symbol: BID
• Synonyms: BID; BH3 interacting domain death agonist; BH3-interacting domain death agonist; p22 BID; BID isoform Si6; BID isoform L(2); BID isoform ES(1b); desmocollin type 4; apoptic death agonist; Human BID coding sequence; FP497; MGC15319; MGC42355
• Gene ID: 637
• mRNA Refseq: NM_001196
• Protein Refseq: NP_001187
• MIM: 601997
• UniProt ID: P55957