Recombinant Human BHLHE23 protein, GST-tagged
Cat.No. : | BHLHE23-301245H |
Product Overview : | Recombinant Human BHLHE23 (173-226 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly173-Pro226 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | BHLHE23 basic helix-loop-helix family, member e23 [ Homo sapiens ] |
Official Symbol | BHLHE23 |
Synonyms | BHLHE23; basic helix-loop-helix family, member e23; basic helix loop helix domain containing, class B, 4 , BHLHB4; class E basic helix-loop-helix protein 23; bA305P22.3; Beta4; bHLHe23; class B basic helix-loop-helix protein 4; basic helix-loop-helix domain containing, class B, 4; BETA4; BHLHB4; |
Gene ID | 128408 |
mRNA Refseq | NM_080606 |
Protein Refseq | NP_542173 |
MIM | 609331 |
UniProt ID | Q8NDY6 |
◆ Recombinant Proteins | ||
BHLHE23-6073C | Recombinant Chicken BHLHE23 | +Inquiry |
BHLHE23-3666H | Recombinant Human BHLHE23 protein, His-tagged | +Inquiry |
BHLHE23-3255Z | Recombinant Zebrafish BHLHE23 | +Inquiry |
BHLHE23-301245H | Recombinant Human BHLHE23 protein, GST-tagged | +Inquiry |
BHLHE23-2600H | Recombinant Human BHLHE23 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BHLHE23 Products
Required fields are marked with *
My Review for All BHLHE23 Products
Required fields are marked with *
0
Inquiry Basket