Recombinant Human BHLHE23 protein, His-tagged

• Cat.No.: BHLHE23-3666H
• Product Overview: Recombinant Human BHLHE23 protein(173-226 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 173-226 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BHLHE23 basic helix-loop-helix family, member e23 [ Homo sapiens ]
• Official Symbol: BHLHE23
• Synonyms: BHLHE23; basic helix-loop-helix family, member e23; basic helix loop helix domain containing, class B, 4 , BHLHB4; class E basic helix-loop-helix protein 23; bA305P22.3; Beta4; bHLHe23; class B basic helix-loop-helix protein 4; basic helix-loop-helix domain containing, class B, 4; BETA4; BHLHB4
• Gene ID: 128408
• mRNA Refseq: NM_080606
• Protein Refseq: NP_542173
• MIM: 609331
• UniProt ID: Q8NDY6