Recombinant Human BEX1 Protein, GST-tagged

• Cat.No.: BEX1-199H
• Product Overview: Human BEX1 full-length ORF ( NP_060946.3, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.3 kDa
• AA Sequence: MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BEX1 brain expressed, X-linked 1 [ Homo sapiens ]
• Official Symbol: BEX1
• Synonyms: BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h
• Gene ID: 55859
• mRNA Refseq: NM_018476
• Protein Refseq: NP_060946
• MIM: 300690
• UniProt ID: Q9HBH7