Recombinant Human BEX1 Protein, GST-tagged
Cat.No. : | BEX1-199H |
Product Overview : | Human BEX1 full-length ORF ( NP_060946.3, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BEX1 brain expressed, X-linked 1 [ Homo sapiens ] |
Official Symbol | BEX1 |
Synonyms | BEX1; brain expressed, X-linked 1; protein BEX1; brain-expressed X-linked protein 1; ovarian granulosa cell 13.0 kDa protein hGR74; BEX2; HBEX2; HGR74-h; |
Gene ID | 55859 |
mRNA Refseq | NM_018476 |
Protein Refseq | NP_060946 |
MIM | 300690 |
UniProt ID | Q9HBH7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BEX1 Products
Required fields are marked with *
My Review for All BEX1 Products
Required fields are marked with *
0
Inquiry Basket