Recombinant Human BCL7A Protein, GST-tagged

• Cat.No.: BCL7A-163H
• Product Overview: Human BCL7A partial ORF ( NP_066273.1, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 31.68 kDa
• AA Sequence: MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEP
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL7A B-cell CLL/lymphoma 7A [ Homo sapiens ]
• Official Symbol: BCL7A
• Synonyms: BCL7A; B-cell CLL/lymphoma 7A; BCL7; B-cell CLL/lymphoma 7 protein family member A; B-cell CLL/lymphoma-7
• Gene ID: 605
• mRNA Refseq: NM_001024808
• Protein Refseq: NP_001019979
• MIM: 601406
• UniProt ID: Q4VC05