Recombinant Human BCL2L11 protein, His-tagged

Cat.No. : BCL2L11-3454H
Product Overview : Recombinant Human BCL2L11 protein(O43521)(1-198aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-198a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.2 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Gene Name BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
Official Symbol BCL2L11
Synonyms BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6;
Gene ID 10018
mRNA Refseq NM_001204106
Protein Refseq NP_001191035
MIM 603827
UniProt ID O43521

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCL2L11 Products

Required fields are marked with *

My Review for All BCL2L11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon