Recombinant Human BCL2L11 protein, His-tagged

• Cat.No.: BCL2L11-3454H
• Product Overview: Recombinant Human BCL2L11 protein(O43521)(1-198aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 1-198a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.2 kDa
• AASequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
• Official Symbol: BCL2L11
• Synonyms: BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6
• Gene ID: 10018
• mRNA Refseq: NM_001204106
• Protein Refseq: NP_001191035
• MIM: 603827
• UniProt ID: O43521