Recombinant Human BCL2L11 protein, GST-tagged

• Cat.No.: BCL2L11-26430TH
• Product Overview: Recombinant Human BCL2L11(1 a.a. - 112 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.8 kDa
• AA Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIL EDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-112 a.a.

Gene Information

• Gene Name: BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
• Official Symbol: BCL2L11
• Synonyms: BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6
• Gene ID: 10018
• mRNA Refseq: NM_207002
• Protein Refseq: NP_996885
• MIM: 603827
• UniProt ID: O43521
• Chromosome Location: 2q13
• Pathway: Activation of BH3-only proteins, organism-specific biosystem; Activation of BIM and translocation to mitochondria, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem
• Function: contributes_to microtubule binding; microtubule binding; protein binding