Recombinant Human BCL2 Protein, GST-tagged

• Cat.No.: BCL2-143H
• Product Overview: Human BCL2 full-length ORF ( AAH27258.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 52.7 kDa
• AA Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL2 B-cell CLL/lymphoma 2 [ Homo sapiens ]
• Official Symbol: BCL2
• Synonyms: BCL2; B-cell CLL/lymphoma 2; apoptosis regulator Bcl-2; Bcl 2; PPP1R50; protein phosphatase 1; regulatory subunit 50; protein phosphatase 1, regulatory subunit 50; Bcl-2
• Gene ID: 596
• mRNA Refseq: NM_000633
• Protein Refseq: NP_000624
• UniProt ID: P10415