Recombinant Human BCAS1 Protein, GST-tagged

Cat.No. : BCAS1-124H
Product Overview : Human BCAS1 partial ORF ( NP_003648, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.54 kDa
AA Sequence : MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAS1 breast carcinoma amplified sequence 1 [ Homo sapiens ]
Official Symbol BCAS1
Synonyms BCAS1; breast carcinoma amplified sequence 1; breast carcinoma-amplified sequence 1; AIBC1; NABC1; novel amplified in breast cancer 1; amplified and overexpressed in breast cancer;
Gene ID 8537
mRNA Refseq NM_003657
Protein Refseq NP_003648
MIM 602968
UniProt ID O75363

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCAS1 Products

Required fields are marked with *

My Review for All BCAS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon