Recombinant Human BCAN Protein, GST-tagged
Cat.No. : | BCAN-115H |
Product Overview : | Human BCAN partial ORF ( NP_068767, 63 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYR |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAN brevican [ Homo sapiens ] |
Official Symbol | BCAN |
Synonyms | BCAN; brevican; brevican core protein; BEHAB; brevican proteoglycan; chondroitin sulfate proteoglycan 7; CSPG7; MGC13038; chondroitin sulfate proteoglycan BEHAB; brain-enriched hyaluronan-binding protein; |
Gene ID | 63827 |
mRNA Refseq | NM_021948 |
Protein Refseq | NP_068767 |
UniProt ID | Q96GW7 |
◆ Recombinant Proteins | ||
BCAN-2532H | Recombinant Human BCAN Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAN-114H | Recombinant Human BCAN Protein, GST-tagged | +Inquiry |
BCAN-5437Z | Recombinant Zebrafish BCAN | +Inquiry |
Bcan-019R | Recombinant Rat Bcan protein, hFc-tagged | +Inquiry |
BCAN-10161H | Recombinant Human BCAN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAN-160HCL | Recombinant Human BCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAN Products
Required fields are marked with *
My Review for All BCAN Products
Required fields are marked with *
0
Inquiry Basket