Recombinant Rat Bcan protein, hFc-tagged

• Cat.No.: Bcan-019R
• Product Overview: Recombinant Rat Bcan protein(P55068)(658-786aa), fused with C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Species: Rat
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 658-786aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.0 kDa
• AA Sequence: DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Bcan brevican [ Rattus norvegicus ]
• Official Symbol: Bcan
• Synonyms: BCAN; brevican; brevican core protein; BEHAB; brain-enriched hyaluronan-binding protein; brevican (brain specific proteoglycan in the aggrecan family); ALPBRE
• Gene ID: 25393
• mRNA Refseq: NM_001033665
• Protein Refseq: NP_001028837