Recombinant Human BAZ2A Protein, GST-tagged

• Cat.No.: BAZ2A-098H
• Product Overview: Human BAZ2A partial ORF ( NP_038477.1, 1681 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAZ2A bromodomain adjacent to zinc finger domain, 2A [ Homo sapiens ]
• Official Symbol: BAZ2A
• Synonyms: BAZ2A; bromodomain adjacent to zinc finger domain, 2A; bromodomain adjacent to zinc finger domain protein 2A; KIAA0314; TIP5; TTF I interacting peptide 5; WALp3; hWALp3; TTF-I interacting peptide 5; TTF-I-interacting protein 5; transcription termination factor I-interacting protein 5; FLJ13768; FLJ13780; FLJ45876; DKFZp781B109
• Gene ID: 11176
• mRNA Refseq: NM_013449
• Protein Refseq: NP_038477
• MIM: 605682
• UniProt ID: Q9UIF9