Recombinant Human BATF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BATF-5417H
• Product Overview: BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
• Molecular Mass: 14.1 kDa
• AA Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BATF basic leucine zipper ATF-like transcription factor [ Homo sapiens (human) ]
• Official Symbol: BATF
• Synonyms: BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2
• Gene ID: 10538
• mRNA Refseq: NM_006399
• Protein Refseq: NP_006390
• MIM: 612476
• UniProt ID: Q16520