Recombinant Human BARX1 protein, GST-tagged

• Cat.No.: BARX1-079H
• Product Overview: Human BARX1 full-length ORF ( AAH09458, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may also be associated with differentiation of stomach epithelia. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BARX1 BARX homeobox 1 [ Homo sapiens ]
• Official Symbol: BARX1
• Synonyms: BARX1; BARX homeobox 1; BarH like homeobox 1; homeobox protein BarH-like 1; BarH-like homeobox 1
• Gene ID: 56033
• mRNA Refseq: NM_021570
• Protein Refseq: NP_067545
• MIM: 603260
• UniProt ID: Q9HBU1