Recombinant Full Length Human BARX1 Protein, GST-tagged
Cat.No. : | BARX1-1818HF |
Product Overview : | Human BARX1 full-length ORF ( AAH09458, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may also be associated with differentiation of stomach epithelia. [provided by RefSeq |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BARX1 BARX homeobox 1 [ Homo sapiens ] |
Official Symbol | BARX1 |
Synonyms | BARX1; BARX homeobox 1; BarH like homeobox 1; homeobox protein BarH-like 1; BarH-like homeobox 1 |
Gene ID | 56033 |
mRNA Refseq | NM_021570 |
Protein Refseq | NP_067545 |
MIM | 603260 |
UniProt ID | Q9HBU1 |
◆ Recombinant Proteins | ||
BARX1-964M | Recombinant Mouse BARX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BARX1-3067Z | Recombinant Zebrafish BARX1 | +Inquiry |
BARX1-1818HF | Recombinant Full Length Human BARX1 Protein, GST-tagged | +Inquiry |
BARX1-2294M | Recombinant Mouse BARX1 Protein | +Inquiry |
BARX1-5767C | Recombinant Chicken BARX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BARX1-154HCL | Recombinant Human BARX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BARX1 Products
Required fields are marked with *
My Review for All BARX1 Products
Required fields are marked with *
0
Inquiry Basket