Recombinant Human BAP1 Protein, His-tagged

• Cat.No.: BAP1-12H
• Product Overview: Recombinant Human BAP1 Protein(575-729 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 575-729 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: LTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: BAP1
• Synonyms: BAP1; BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase); ubiquitin carboxyl-terminal hydrolase BAP1; hucep 6; KIAA0272; UCHL2; cerebral protein 6; cerebral protein-13; TPDS; hucep-6; HUCEP-13; FLJ35406; FLJ37180; DKFZp686N04275
• Gene ID: 8314
• mRNA Refseq: NM_004656
• Protein Refseq: NP_004647
• MIM: 603089
• UniProt ID: Q92560