Recombinant Full Length Human BAP1 Protein, C-Flag-tagged
Cat.No. : | BAP1-1599HFL |
Product Overview : | Recombinant Full Length Human BAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the ubiquitin C-terminal hydrolase subfamily of deubiquitinating enzymes that are involved in the removal of ubiquitin from proteins. The encoded enzyme binds to the breast cancer type 1 susceptibility protein (BRCA1) via the RING finger domain of the latter and acts as a tumor suppressor. In addition, the enzyme may be involved in regulation of transcription, regulation of cell cycle and growth, response to DNA damage and chromatin dynamics. Germline mutations in this gene may be associated with tumor predisposition syndrome (TPDS), which involves increased risk of cancers including malignant mesothelioma, uveal melanoma and cutaneous melanoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 80.2 kDa |
AA Sequence : | MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTS VIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKA HNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVI MERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQ LPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNP TPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSN ESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTG LLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPK ELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRR RQGVSIGRLHKQRKPDRRKRSRPYKAKRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | BAP1 BRCA1 associated protein 1 [ Homo sapiens (human) ] |
Official Symbol | BAP1 |
Synonyms | UVM2; KURIS; TPDS1; UCHL2; hucep-6; HUCEP-13 |
Gene ID | 8314 |
mRNA Refseq | NM_004656.4 |
Protein Refseq | NP_004647.1 |
MIM | 603089 |
UniProt ID | Q92560 |
◆ Recombinant Proteins | ||
BAP1-0382H | Recombinant Human BAP1 Protein (N2-Q729), His tagged | +Inquiry |
BAP1-597R | Recombinant Rat BAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAP1-13H | Recombinant Human BAP1 Protein, GST-tagged | +Inquiry |
BAP1-167H | Active Recombinant Human BAP1 protein, His-tagged | +Inquiry |
BAP1-2290M | Recombinant Mouse BAP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAP1-8515HCL | Recombinant Human BAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAP1 Products
Required fields are marked with *
My Review for All BAP1 Products
Required fields are marked with *
0
Inquiry Basket