Recombinant Human BAK1 Protein, His-tagged

• Cat.No.: BAK1-35H
• Product Overview: Recombinant Human BAK1 Protein was expressed in E. coli with His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGIN
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ]
• Official Symbol: BAK1
• Synonyms: BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK; BAK-LIKE; MGC3887; MGC117255
• Gene ID: 578
• mRNA Refseq: NM_001188
• Protein Refseq: NP_001179
• MIM: 600516
• UniProt ID: Q16611