Recombinant Human BAK1

• Cat.No.: BAK1-26168TH
• Product Overview: Recombinant fragment corresponding to amino acids 100-211 of Human Bak with an N terminal proprietary tag; Predicted MWt 37.95 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 112 amino acids
• Description: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
• Molecular Weight: 37.950kDa inclusive of tags
• Tissue specificity: Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
• Sequence Similarities: Belongs to the Bcl-2 family.

Gene Information

• Gene Name: BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ]
• Official Symbol: BAK1
• Synonyms: BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7
• Gene ID: 578
• mRNA Refseq: NM_001188
• Protein Refseq: NP_001179
• MIM: 600516
• Uniprot ID: Q16611
• Chromosome Location: 6p21.31
• Pathway: Activation and oligomerization of BAK protein, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Intrinsic Pathway for Apoptosis, organism-specific biosystem
• Function: BH domain binding; chaperone binding; heat shock protein binding; identical protein binding; metal ion binding