Recombinant Human Baculoviral IAP Repeat Containing 5, His-tagged

• Cat.No.: BIRC5-4944H
• Product Overview: Recombinant human BIRC5 containing N-terminal His tag was expressed in E. coli, 18.6 kDa.

Specification

• Cat. No.: BIRC5-4944H
• Description: Survivin, a member of the inhibitor of apoptosis (IAP) family, is also called baculoviral inhibitor of apoptosis repeat-containing 5 or BIRC5 and in humans is encoded by the BIRC5 gene. The survivin protein functions to inhibit caspase activation, thereby leading to negative regulation of apoptosis. Disruption of survivin induction pathways leads to an increase in apoptosis and decrease in tumour growth. Survivin is highly expressed in most human tumours and fetal tissue, but is completely absent in terminally differentiated cells, making survivin an ideal target for studying cancer therapy.
• Molecular Weight: 18.6 kDa
• Source: E. coli
• Species: Human
• Form: Sterile filtered and lyophilized with no additives.
• Appearance: Lyophilized protein
• Sequence: MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDH RISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCF FCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLG EFLKLDRERAKNKIAKETNNKKKEFEETVKKVRRAIEQLAAM D
• Endotoxin Level: <0.1 ng/μg
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute to a concentration of 0.1-1.0 mg/ml in PBS.
• Purity: >90 % as determined by SDS-PAGE.
• Storage: Aliquot and Store at –80°C. Stable for 6-12 months. Avoid freeze/thaw cycles.
• Pathways: Apoptosis; Aurora A signaling; Aurora B signaling; Cell Cycle, Mitotic; Colorectal cancer; DNA Replication; FOXM1 transcription factor network; IL-3 Signaling Pathway; M Phase; Mitotic M-M/G1 phases; Pathways in cancer; Validated targets of C-MYC transcriptional activation

Gene Information

• Gene Name: BIRC5 baculoviral IAP repeat-containing 5 [ Homo sapiens ]
• Official Symbol: BIRC5
• Synonyms: BIRC5; baculoviral IAP repeat containing 5; API4; EPR-1; baculoviral IAP repeat-containing protein 5; apoptosis inhibitor 4; survivin variant 3 alpha; apoptosis inhibitor survivin; Apoptosis inhibitor survivin; Apoptosis inhibitor 4; IAP4
• Gene ID: 332
• mRNA Refseq: NM_001012270
• Protein Refseq: NP_001012270
• MIM: 603352
• UniProt ID: O15392
• Chromosome Location: 17q25
• Function: Ran GTPase binding; caspase inhibitor activity; chaperone binding; cobalt ion binding; cofactor binding; cysteine-type endopeptidase inhibitor activity; enzyme binding; identical protein binding; metal ion binding; microtubule binding; peptidase inhibitor activity; protein binding; protein heterodimerization activity; tubulin binding; zinc ion binding