Recombinant Human BIRC5 Protein, His tagged

• Cat.No.: BIRC5-31754TH
• Product Overview: Recombinant Human BIRC5 protein (1-142 aa) with His tag was expressed in E. coli.

Specification

• Description: This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-142 aa
• Molecular Mass: 19 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.11 mg/mL by BCA

Gene Information

• Gene Name: BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens (human) ]
• Official Symbol: BIRC5
• Synonyms: BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4, baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1
• Gene ID: 332
• mRNA Refseq: NM_001012270
• Protein Refseq: NP_001012270
• MIM: 603352
• UniProt ID: O15392