Recombinant Human BACH1 Protein, GST-tagged

• Cat.No.: BACH1-27427H
• Product Overview: Human BACH1 partial ORF ( NP_996749, 396 a.a.-492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ.

Specification

• Description: This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.41 kDa
• Protein length: 396-492
• AA Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BACH1 BTB domain and CNC homolog 1 [ Homo sapiens (human) ]
• Official Symbol: BACH1
• Synonyms: BACH1; BTB domain and CNC homolog 1; BACH-1; BTBD24; transcription regulator protein BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; basic region leucine zipper transcriptional regulator BACH1
• Gene ID: 571
• mRNA Refseq: NM_206866
• Protein Refseq: NP_996749
• MIM: 602751
• UniProt ID: O14867