Recombinant Full Length Human BACH1 Protein, C-Flag-tagged
Cat.No. : | BACH1-254HFL |
Product Overview : | Recombinant Full Length Human BACH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | BACH1 BTB domain and CNC homolog 1 [ Homo sapiens (human) ] |
Official Symbol | BACH1 |
Synonyms | BACH-1; BTBD24 |
Gene ID | 571 |
mRNA Refseq | NM_001186.4 |
Protein Refseq | NP_001177.1 |
MIM | 602751 |
UniProt ID | O14867 |
◆ Recombinant Proteins | ||
BACH1-254HFL | Recombinant Full Length Human BACH1 Protein, C-Flag-tagged | +Inquiry |
BACH1-504R | Recombinant Rhesus monkey BACH1 Protein, His-tagged | +Inquiry |
BACH1-001H | Recombinant Human BACH1 Protein, MYC/DDK-tagged | +Inquiry |
BACH1-27427H | Recombinant Human BACH1 Protein, GST-tagged | +Inquiry |
BACH1-044H | Recombinant Human BACH1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACH1-8531HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
BACH1-8532HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BACH1 Products
Required fields are marked with *
My Review for All BACH1 Products
Required fields are marked with *
0
Inquiry Basket