Recombinant Human B4GALT4 protein, His-tagged
Cat.No. : | B4GALT4-392H |
Product Overview : | Recombinant Human B4GALT4(Gln39-Ala344) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Gln39-Ala344 |
Form : | Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5 |
AA Sequence : | QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQA ENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKF NRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFG GVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVN AERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | B4GALT4 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [ Homo sapiens ] |
Official Symbol | B4GALT4 |
Synonyms | B4GALT4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; beta-1,4-galactosyltransferase 4; beta4Gal T4; beta-1,4-GalTase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; B4Gal-T4; beta4Gal-T4; |
Gene ID | 8702 |
mRNA Refseq | NM_003778 |
Protein Refseq | NP_003769 |
MIM | 604015 |
UniProt ID | O60513 |
Chromosome Location | 3q13.3 |
Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer, organism-specific biosystem; |
Function | N-acetyllactosamine synthase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
B4galt4-20HCL | Recombinant Mouse B4galt4 overexpression lysate | +Inquiry |
B4GALT4-1743HF | Recombinant Full Length Human B4GALT4 Protein, GST-tagged | +Inquiry |
B4GALT4-392H | Recombinant Human B4GALT4 protein, His-tagged | +Inquiry |
B4GALT4-2643H | Recombinant Human B4GALT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B4GALT4-922R | Recombinant Rat B4GALT4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT4-8537HCL | Recombinant Human B4GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GALT4 Products
Required fields are marked with *
My Review for All B4GALT4 Products
Required fields are marked with *
0
Inquiry Basket