Recombinant Human B4GALT4 protein, His-tagged

• Cat.No.: B4GALT4-392H
• Product Overview: Recombinant Human B4GALT4(Gln39-Ala344) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5
• Protein length: Gln39-Ala344
• AA Sequence: QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQA ENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKF NRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFG GVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVN AERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: B4GALT4 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [ Homo sapiens ]
• Official Symbol: B4GALT4
• Synonyms: B4GALT4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; beta-1,4-galactosyltransferase 4; beta4Gal T4; beta-1,4-GalTase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; B4Gal-T4; beta4Gal-T4
• Gene ID: 8702
• mRNA Refseq: NM_003778
• Protein Refseq: NP_003769
• MIM: 604015
• UniProt ID: O60513
• Chromosome Location: 3q13.3
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer, organism-specific biosystem
• Function: N-acetyllactosamine synthase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups