Recombinant Human B2M protein, GST-tagged

• Cat.No.: B2M-002H
• Product Overview: Human B2M full-length ORF ( AAH32589, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.83 kDa
• AA Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: B2M beta-2-microglobulin [ Homo sapiens ]
• Official Symbol: B2M
• Synonyms: B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules
• Gene ID: 567
• mRNA Refseq: NM_004048
• Protein Refseq: NP_004039
• MIM: 109700
• UniProt ID: P61769