Recombinant Human AXIN1 protein, GST-tagged
Cat.No. : | AXIN1-1047H |
Product Overview : | Human AXIN1 partial ORF ( NP_003493, 643 a.a. - 740 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AXIN1 axin 1 [ Homo sapiens ] |
Official Symbol | AXIN1 |
Synonyms | AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; axis inhibitor 1; fused, mouse, homolog of; axis inhibition protein 1; protein phosphatase 1, regulatory subunit 49; AXIN; MGC52315; |
Gene ID | 8312 |
mRNA Refseq | NM_003502 |
Protein Refseq | NP_003493 |
MIM | 603816 |
UniProt ID | O15169 |
◆ Recombinant Proteins | ||
AXIN1-10084H | Recombinant Human AXIN1, His-tagged | +Inquiry |
AXIN1-9053Z | Recombinant Zebrafish AXIN1 | +Inquiry |
AXIN1-388H | Recombinant Human AXIN1 Protein, His-tagged | +Inquiry |
AXIN1-106H | Recombinant Human AXIN1, MYC/DDK-tagged | +Inquiry |
AXIN1-105H | Recombinant Human AXIN1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AXIN1 Products
Required fields are marked with *
My Review for All AXIN1 Products
Required fields are marked with *
0
Inquiry Basket