Recombinant Human ATP6V1E1 protein, GST-tagged

• Cat.No.: ATP6V1E1-1006H
• Product Overview: Human ATP6V1E1 full-length ORF ( AAH04443, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008]
• Molecular Mass: 50.60 kDa
• AA Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6V1E1 ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 [ Homo sapiens ]
• Official Symbol: ATP6V1E1
• Synonyms: ATP6V1E1; ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1; ATP6E, ATP6V1E, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD , ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1; V-type proton ATPase subunit E 1; ATP6E2; P31; Vma4; V-ATPase, subunit E; V-ATPase subunit E 1; V-ATPase 31 kDa subunit; vacuolar proton pump subunit E 1; H+-transporting ATP synthase chain E, vacuolar; H(+)-transporting two-sector ATPase, 31kDa subunit; ATP6E; ATP6V1E
• Gene ID: 529
• mRNA Refseq: NM_001039366
• Protein Refseq: NP_001034455
• MIM: 108746
• UniProt ID: P36543