Recombinant Human ATP6V1D protein, GST-tagged

Cat.No. : ATP6V1D-1005H
Product Overview : Human ATP6V1D full-length ORF ( AAH01411, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes the V1 domain D subunit protein. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 52.91 kDa
AA Sequence : MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6V1D ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [ Homo sapiens ]
Official Symbol ATP6V1D
Synonyms ATP6V1D; ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D; ATP6M, ATPase, H+ transporting, lysosomal (vacuolar proton pump); V-type proton ATPase subunit D; VATD; VMA8; V-ATPase D subunit; V-ATPase subunit D; vacuolar H-ATPase subunit D; vacuolar proton pump D subunit; vacuolar proton pump subunit D; vacuolar ATP synthase subunit D; vacuolar proton-ATPase subunit D; V-ATPase 28 kDa accessory protein; vacuolar proton pump delta polypeptide; ATPase, H+ transporting lysosomal, member M; H(+)-transporting two-sector ATPase, subunit M; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATP6M;
Gene ID 51382
mRNA Refseq NM_015994
Protein Refseq NP_057078
MIM 609398
UniProt ID Q9Y5K8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP6V1D Products

Required fields are marked with *

My Review for All ATP6V1D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon