Recombinant Human ATP5PO Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ATP5PO-1620H
• Product Overview: ATP5O MS Standard C13 and N15-labeled recombinant protein (NP_001688) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 23.3 kDa
• AA Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ATP5PO ATP synthase peripheral stalk subunit OSCP [ Homo sapiens (human) ]
• Official Symbol: ATP5PO
• Synonyms: ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein
• Gene ID: 539
• mRNA Refseq: NM_001697
• Protein Refseq: NP_001688
• MIM: 600828
• UniProt ID: P48047