Recombinant Human ATP5PO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATP5PO-1620H |
Product Overview : | ATP5O MS Standard C13 and N15-labeled recombinant protein (NP_001688) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATP5PO ATP synthase peripheral stalk subunit OSCP [ Homo sapiens (human) ] |
Official Symbol | ATP5PO |
Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; |
Gene ID | 539 |
mRNA Refseq | NM_001697 |
Protein Refseq | NP_001688 |
MIM | 600828 |
UniProt ID | P48047 |
◆ Recombinant Proteins | ||
ATP5PO-1194H | Recombinant Human ATP5PO Protein (24-213 aa), GST-tagged | +Inquiry |
ATP5PO-1620H | Recombinant Human ATP5PO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5PO Products
Required fields are marked with *
My Review for All ATP5PO Products
Required fields are marked with *
0
Inquiry Basket