Recombinant Human ATP5PO Protein (24-213 aa), GST-tagged
Cat.No. : | ATP5PO-1194H |
Product Overview : | Recombinant Human ATP5PO Protein (24-213 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-213 aa |
Description : | Mitochondrial mbrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the mbrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extrambraneous catalytic core and F0 - containing the mbrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elents. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 47.9 kDa |
AA Sequence : | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ATP5PO ATP synthase peripheral stalk subunit OSCP [ Homo sapiens (human) ] |
Official Symbol | ATP5PO |
Synonyms | ATPO; OSCP; ATP5O; HMC08D05; |
Gene ID | 539 |
mRNA Refseq | NM_001697 |
Protein Refseq | NP_001688 |
UniProt ID | P48047 |
◆ Recombinant Proteins | ||
ATP5PO-1620H | Recombinant Human ATP5PO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP5PO-1194H | Recombinant Human ATP5PO Protein (24-213 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5PO Products
Required fields are marked with *
My Review for All ATP5PO Products
Required fields are marked with *
0
Inquiry Basket