Recombinant Human ATP5PF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATP5PF-4191H |
Product Overview : | ATP5J MS Standard C13 and N15-labeled recombinant protein (NP_001003696) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo complex has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the Fo complex. The F6 subunit is required for F1 and Fo interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has 1 or more pseudogenes. |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFHTFKFEDPKFEVIEKPQATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATP5PF ATP synthase peripheral stalk subunit F6 [ Homo sapiens (human) ] |
Official Symbol | ATP5PF |
Synonyms | ATP5J; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, ATP5, ATP5A, ATPM; ATP synthase-coupling factor 6, mitochondrial; CF6; coupling factor 6; ATPase subunit F6; proliferation-inducing protein 36; mitochondrial ATP synthase, subunit F6; mitochondrial ATPase coupling factor 6; mitochondrial ATP synthase, coupling factor 6; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; F6; ATP5; ATPM; ATP5A; |
Gene ID | 522 |
mRNA Refseq | NM_001003696 |
Protein Refseq | NP_001003696 |
MIM | 603152 |
UniProt ID | P18859 |
◆ Recombinant Proteins | ||
ATP5PF-0286H | Recombinant Human ATP5PF Protein (Met1-Ala108), N-His-tagged | +Inquiry |
ATP5PF-4191H | Recombinant Human ATP5PF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP5PF-2034H | Recombinant Human ATP5PF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5PF Products
Required fields are marked with *
My Review for All ATP5PF Products
Required fields are marked with *
0
Inquiry Basket