Recombinant Human ATP5PF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ATP5PF-2034H
Product Overview : ATP5J MS Standard C13 and N15-labeled recombinant protein (NP_001676) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo complex has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the Fo complex. The F6 subunit is required for F1 and Fo interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has 1 or more pseudogenes.
Molecular Mass : 12.59 kDa
AA Sequence : MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ATP5PF ATP synthase peripheral stalk subunit F6 [ Homo sapiens (human) ]
Official Symbol ATP5PF
Synonyms ATP5PF; ATP synthase peripheral stalk subunit F6; F6; CF6; ATP5; ATPM; ATP5A; ATP5J; ATP synthase-coupling factor 6, mitochondrial; ATP synthase subunit h; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; ATP synthase, H+ transporting, mitochondrial Fo complex subunit F6; ATPase subunit F6; coupling factor 6; mitochondrial ATP synthase, coupling factor 6; mitochondrial ATP synthase, subunit F6; mitochondrial ATPase coupling factor 6; proliferation-inducing protein 36; EC 3.6.1.14
Gene ID 522
mRNA Refseq NM_001685
Protein Refseq NP_001676
MIM 603152
UniProt ID P18859

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP5PF Products

Required fields are marked with *

My Review for All ATP5PF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon