Recombinant Human ATP5O, His-tagged

• Cat.No.: ATP5O-27062TH
• Product Overview: Recombinant full length Human ATP5O with an N terminal His tag; 211 amino acids with tag, Predicted MWt 23.1 kDa.

Specification

• Description: The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
• Protein length: 190 amino acids
• Conjugation: HIS
• Molecular Weight: 23.100kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
• Sequence Similarities: Belongs to the ATPase delta chain family.

Gene Information

• Gene Name: ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ]
• Official Symbol: ATP5O
• Synonyms: ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP
• Gene ID: 539
• mRNA Refseq: NM_001697
• Protein Refseq: NP_001688
• MIM: 600828
• Uniprot ID: P48047
• Chromosome Location: 21q22
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem
• Function: contributes_to ATPase activity; drug binding; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein complex binding; steroid binding