Recombinant Human ATP2B4 protein, GST-tagged

Cat.No. : ATP2B4-973H
Product Overview : Human ATP2B4 partial ORF ( NP_001675, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.86 kDa
AA Sequence : MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP2B4 ATPase, Ca++ transporting, plasma membrane 4 [ Homo sapiens ]
Official Symbol ATP2B4
Synonyms ATP2B4; ATPase, Ca++ transporting, plasma membrane 4; ATP2B2, matrix remodelling associated 1 , MXRA1; plasma membrane calcium-transporting ATPase 4; plasma membrane calcium transporting ATPase 4; PMCA4; sarcolemmal calcium pump; matrix-remodeling-associated protein 1; MXRA1; ATP2B2; PMCA4b; PMCA4x; DKFZp686M088; DKFZp686G08106;
Gene ID 493
mRNA Refseq NM_001001396
Protein Refseq NP_001001396
MIM 108732
UniProt ID P23634

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP2B4 Products

Required fields are marked with *

My Review for All ATP2B4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon