Recombinant Human ATP1A3 protein, GST-tagged
Cat.No. : | ATP1A3-3256H |
Product Overview : | Recombinant Human ATP1A3 protein(1-65 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-65 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | ATP1A3 ATPase, Na+/K+ transporting, alpha 3 polypeptide [ Homo sapiens ] |
Official Symbol | ATP1A3 |
Synonyms | ATP1A3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; dystonia 12 , DYT12; sodium/potassium-transporting ATPase subunit alpha-3; Na+/K+ ATPase 3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit; sodium-potassium-ATPase, alpha 3 polypeptide; sodium/potassium-transporting ATPase alpha-3 chain; RDP; DYT12; MGC13276 |
Gene ID | 478 |
mRNA Refseq | NM_001256213 |
Protein Refseq | NP_001243142 |
MIM | 182350 |
UniProt ID | P13637 |
◆ Recombinant Proteins | ||
ATP1A3-3255H | Recombinant Human ATP1A3 protein, His-tagged | +Inquiry |
ATP1A3-510R | Recombinant Rat ATP1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1A3-2649H | Recombinant Human ATP1A3 protein(171-240 aa), C-His-tagged | +Inquiry |
ATP1A3-2517H | Recombinant Human ATP1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1A3-963H | Recombinant Human ATP1A3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1A3-8611HCL | Recombinant Human ATP1A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP1A3 Products
Required fields are marked with *
My Review for All ATP1A3 Products
Required fields are marked with *
0
Inquiry Basket