Recombinant Human ATP1A3 protein(171-240 aa), C-His-tagged

• Cat.No.: ATP1A3-2649H
• Product Overview: Recombinant Human ATP1A3 protein(P13637)(171-240 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 171-240 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: NAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ATP1A3 ATPase, Na+/K+ transporting, alpha 3 polypeptide [ Homo sapiens ]
• Official Symbol: ATP1A3
• Synonyms: ATP1A3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; dystonia 12 , DYT12; sodium/potassium-transporting ATPase subunit alpha-3; Na+/K+ ATPase 3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit; sodium-potassium-ATPase, alpha 3 polypeptide; sodium/potassium-transporting ATPase alpha-3 chain; RDP; DYT12; MGC13276
• Gene ID: 478
• mRNA Refseq: NM_001256213
• Protein Refseq: NP_001243142
• MIM: 182350
• UniProt ID: P13637