Recombinant Human ATP1A3 protein(171-240 aa), C-His-tagged

Cat.No. : ATP1A3-2649H
Product Overview : Recombinant Human ATP1A3 protein(P13637)(171-240 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 171-240 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
Gene Name ATP1A3 ATPase, Na+/K+ transporting, alpha 3 polypeptide [ Homo sapiens ]
Official Symbol ATP1A3
Synonyms ATP1A3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; dystonia 12 , DYT12; sodium/potassium-transporting ATPase subunit alpha-3; Na+/K+ ATPase 3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit; sodium-potassium-ATPase, alpha 3 polypeptide; sodium/potassium-transporting ATPase alpha-3 chain; RDP; DYT12; MGC13276;
Gene ID 478
mRNA Refseq NM_001256213
Protein Refseq NP_001243142
MIM 182350
UniProt ID P13637

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP1A3 Products

Required fields are marked with *

My Review for All ATP1A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon