Recombinant Human ATP12A protein, GST-tagged

• Cat.No.: ATP12A-961H
• Product Overview: Human ATP12A partial ORF ( NP_001667, 174 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
• Molecular Mass: 37.62 kDa
• AA Sequence: SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVIN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP12A ATPase, H+/K+ transporting, nongastric, alpha polypeptide [ Homo sapiens ]
• Official Symbol: ATP12A
• Synonyms: ATP12A; ATPase, H+/K+ transporting, nongastric, alpha polypeptide; ATP1AL1, ATPase, Na+/K+ transporting, alpha polypeptide like 1; potassium-transporting ATPase alpha chain 2; ATPase; Na+K+ transporting; alpha 1 polypeptide like; non gastric H(+)/K(+) ATPase alpha subunit; potassium transporting ATPase alpha chain 2; proton pump; sodium/potassium ATPase; alpha polypeptide like; non-gastric H(+)/K(+) ATPase alpha subunit; non-gastric H(+)/K(+) ATPase subunit alpha; ATPase, Na+/K+ transporting, alpha polypeptide-like 1; ATP1AL1
• Gene ID: 479
• mRNA Refseq: NM_001185085
• Protein Refseq: NP_001172014
• MIM: 182360
• UniProt ID: P54707