Recombinant Human ATP12A protein, GST-tagged
Cat.No. : | ATP12A-961H |
Product Overview : | Human ATP12A partial ORF ( NP_001667, 174 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVIN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP12A ATPase, H+/K+ transporting, nongastric, alpha polypeptide [ Homo sapiens ] |
Official Symbol | ATP12A |
Synonyms | ATP12A; ATPase, H+/K+ transporting, nongastric, alpha polypeptide; ATP1AL1, ATPase, Na+/K+ transporting, alpha polypeptide like 1; potassium-transporting ATPase alpha chain 2; ATPase; Na+K+ transporting; alpha 1 polypeptide like; non gastric H(+)/K(+) ATPase alpha subunit; potassium transporting ATPase alpha chain 2; proton pump; sodium/potassium ATPase; alpha polypeptide like; non-gastric H(+)/K(+) ATPase alpha subunit; non-gastric H(+)/K(+) ATPase subunit alpha; ATPase, Na+/K+ transporting, alpha polypeptide-like 1; ATP1AL1; |
Gene ID | 479 |
mRNA Refseq | NM_001185085 |
Protein Refseq | NP_001172014 |
MIM | 182360 |
UniProt ID | P54707 |
◆ Recombinant Proteins | ||
ATP12A-507R | Recombinant Rat ATP12A Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP12A-2107M | Recombinant Mouse ATP12A Protein | +Inquiry |
ATP12A-263H | Recombinant Human ATP12A Protein, His-tagged | +Inquiry |
ATP12A-2598C | Recombinant Chicken ATP12A | +Inquiry |
ATP12A-961H | Recombinant Human ATP12A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP12A-8614HCL | Recombinant Human ATP12A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP12A Products
Required fields are marked with *
My Review for All ATP12A Products
Required fields are marked with *
0
Inquiry Basket