Recombinant Human ATIC protein, GST-tagged

• Cat.No.: ATIC-25H
• Product Overview: Recombinant Human ATIC protein(NP_004035.2)(291-592 aa) was fused to GST-tagged and expressed in E. coli.

Specification

• Description: This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Bio-activity: Not tested.
• Protein length: 291-592 aa
• AA Sequence: DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
• Endotoxin: <1.0 EU per μg protein as determined by the LAL method.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Applications: Blocking peptide
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature(see below).

Gene Information

• Gene Name: ATIC
• Official Symbol: ATIC
• Synonyms: AICAR; AICARFT; FLJ93545; IMPCHASE; PURH
• Gene ID: 471
• mRNA Refseq: NM_004044.7
• Protein Refseq: NP_004035.2
• MIM: 601731
• UniProt ID: P31939