Recombinant Human ATG4B protein, GST-tagged

• Cat.No.: ATG4B-949H
• Product Overview: Human ATG4B full-length ORF ( AAH00719.1, 1 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 70.7 kDa
• AA Sequence: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG4B ATG4 autophagy related 4 homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4B
• Synonyms: ATG4B; ATG4 autophagy related 4 homolog B (S. cerevisiae); APG4 autophagy 4 homolog B (S. cerevisiae) , APG4B; cysteine protease ATG4B; Apg4B; AUTL1; DKFZp586D1822; KIAA0943; hAPG4B; autophagin-1; APG4 autophagy 4 homolog B; AUT-like 1 cysteine endopeptidase; autophagy-related protein 4 homolog B; autophagy-related cysteine endopeptidase 1; APG4B; MGC1353
• Gene ID: 23192
• mRNA Refseq: NM_013325
• Protein Refseq: NP_037457
• MIM: 611338
• UniProt ID: Q9Y4P1